BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0572 (766 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyce... 28 1.7 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 9.0 >SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyces pombe|chr 1|||Manual Length = 469 Score = 27.9 bits (59), Expect = 1.7 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 9/70 (12%) Frame = +2 Query: 83 DFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKVPN------AEDKLKVEKLIDA- 241 DF EN+ + +L + + ++ KDG + +D+ + N A +K K E DA Sbjct: 84 DFMDENKENGRISLGLSVIVRVTIKDGAYHEDIGYGSIDNCRGKASAFEKCKKEGTTDAL 143 Query: 242 --CLANKGNS 265 L N GNS Sbjct: 144 KRALRNFGNS 153 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 25.4 bits (53), Expect = 9.0 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -2 Query: 582 PRSIKRDKQSYDEHKRKLNFISRLNMLKQQNKIYRTD 472 P ++ D H +KLN +S+LN + + + + D Sbjct: 321 PLESRKLHSKVDVHSKKLNALSQLNPILRSENVLQND 357 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,963,997 Number of Sequences: 5004 Number of extensions: 60693 Number of successful extensions: 165 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -