BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0572 (766 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.64 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 31 1.1 At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 29 2.6 At5g17240.1 68418.m02020 SET domain-containing protein contains ... 29 3.4 At4g02710.1 68417.m00366 kinase interacting family protein simil... 29 4.5 At1g80410.1 68414.m09413 acetyltransferase-related low similarit... 29 4.5 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 28 5.9 At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-contai... 28 5.9 At2g37050.1 68415.m04546 leucine-rich repeat family protein / pr... 28 7.8 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.64 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 326 ERASGLSRGSISHNSRLFGEGCCLCWPGKRQS 231 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = +2 Query: 23 ADCLSETKADE--QLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKV 196 A+ ++ET E + LK + + N +K C+++ S+ F+K + L + Sbjct: 479 AEDIAETMDAEVVEAQKMLKLAEAQRMNTDSRKAIFCVIMSSEDYID--AFEKLLRL-DL 535 Query: 197 PNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 328 P +D+ + L++ CL K + T C H+K+ K L Sbjct: 536 PGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDKNHKFTL 579 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +2 Query: 8 LKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 166 +K+H CL+ + DE N L+T + K + P+K+ A L K KDGK Sbjct: 83 VKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At5g17240.1 68418.m02020 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 491 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +2 Query: 107 LKKYALCMLI-KSQLMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 283 LKK L + + + LMT + KD+ L+ N + L +++ CL + + ++ W Sbjct: 57 LKKGELVLKVPRKALMTTESIIAKDLKLSDAVNLHNSLSSTQILSVCLLYEMSKEKKSFW 116 Query: 284 NYVKCYH 304 Y +H Sbjct: 117 -YPYLFH 122 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 347 DYVFTRKERASGLSRGSISHNSRLFGEGCCL 255 DYVFT +E A +S+G+ + L EG CL Sbjct: 781 DYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At1g80410.1 68414.m09413 acetyltransferase-related low similarity to acetyltransferase Tubedown-1 [Mus musculus] GI:8497318, N-TERMINAL ACETYLTRANSFERASE GB:P12945 from (Saccharomyces cerevisiae); contains Pfam profile PF00515 TPR Domain Length = 897 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = -2 Query: 591 KKSPRSIKRDKQSYDEHKRKLNFISRLNMLKQQNKIYR 478 KK P+ + DK SY E ++++ +S++ L++ NK+YR Sbjct: 214 KKEPKIV--DKLSYKE--QEVSLLSKVGRLEEANKLYR 247 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +2 Query: 17 HRADCLSETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 190 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 191 KVPN 202 N Sbjct: 287 DGEN 290 >At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-containing protein similar to AX110P [Daucus carota] GI:285739; contains Pfam profile PF01408: Oxidoreductase family NAD-binding Rossmann fold Length = 364 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 170 KKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 283 KK L + P A+D ++EK+++AC N T W Sbjct: 95 KKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132 >At2g37050.1 68415.m04546 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 934 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -1 Query: 622 AASCLSLYEMKEITKKHQTR 563 AA C +LYE++E TKK + R Sbjct: 590 AAHCFTLYEIEEATKKFEKR 609 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,963,544 Number of Sequences: 28952 Number of extensions: 298329 Number of successful extensions: 708 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -