BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0571 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 23 9.6 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 9.6 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 23.0 bits (47), Expect = 9.6 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 9/60 (15%) Frame = +3 Query: 459 SGVFVFK--PSNETF--EKLIQFAQQRGSFD-----GGDQGLLNSFFSDWAHGDINKHLP 611 +G+FV + P ++T+ + + ++ + S D G L+N + SD HG I LP Sbjct: 162 NGIFVQRNIPLSDTYRNQSMTYYSSEVQSLDFELDTSGSTRLINRWVSDKTHGKIPNILP 221 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.0 bits (47), Expect = 9.6 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 537 DGGDQGLLNSFFSDWAHGDINKHL 608 DG D + S HG++ KH+ Sbjct: 240 DGFDPAVCQDIASQLIHGEVGKHM 263 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 731,598 Number of Sequences: 2352 Number of extensions: 15190 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -