BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0567 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) 111 5e-25 SB_27851| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.093 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 29 3.5 SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) 29 4.6 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 28 8.1 SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16) 28 8.1 >SB_6632| Best HMM Match : FAD_binding_4 (HMM E-Value=1.70006e-41) Length = 482 Score = 111 bits (267), Expect = 5e-25 Identities = 60/156 (38%), Positives = 87/156 (55%), Gaps = 7/156 (4%) Frame = +3 Query: 171 RQDLLKWYGWGYKDTMFKFSSES-AAFTGNRYSIAGKCLPHLPQWAIDNFGIDPDSPPKI 347 R LKW GWGY D+ F+ + A+FTG+RY ++G+ P L W + D + K Sbjct: 38 RHGELKWNGWGYNDSKFQLDKDGKASFTGSRYLLSGQTFPKLVDWFLKECSADLNK--KS 95 Query: 348 PEAPSSFAESRLPENVKDE--LEMIAAVSV----DGMDRLIRAHGQTLKDIANVRNNNFR 509 P P + LP+ + +E L+ I+ ++V D RL HG T +I +R+ Sbjct: 96 PANPLP-DPATLPQPISNEDFLKAISQINVQFTQDAHQRLFHCHGHTGHEIFILRHGKPE 154 Query: 510 RIPDAVIWPDCHEQVEKIVQCASRHNFVIIPFGGGT 617 RIPD V+WP CH++VE IV+ A + N +IPFGGGT Sbjct: 155 RIPDVVVWPHCHDEVESIVKAAVQCNVCVIPFGGGT 190 >SB_27851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 34.3 bits (75), Expect = 0.093 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 516 PDAVIWPDCHEQVEKIVQCASRHNFVIIPFGGGT 617 PD V++P EQV +I + H+ ++P G GT Sbjct: 32 PDLVVFPTSREQVSEIAKICYEHSVPMVPHGSGT 65 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 651 FSGQVTAPGHRTCPHRKE*SRSCAATHIGLSFLPAHDNLA 532 F Q + P HRT P ++ S ++ H GL P+ L+ Sbjct: 4 FGRQDSIPAHRTSPQEEDLSHDTSSLHAGLMTEPSFHRLS 43 >SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) Length = 761 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -2 Query: 160 IALLTFIIIVFADSFLFLSLGYFIFNTLHCSFTSIVYISQIF 35 I F+I VF F+F+ +F+F + F S+V++ +F Sbjct: 707 IFFFAFVIFVFNAFFVFVVFAFFVF-LVFVFFVSVVFVFFVF 747 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 291 LPQWAIDNFGIDPDSPPKIPEAPSSFAESRLPENVKD 401 LP W + N+ D + P SSFAE +LP + KD Sbjct: 447 LPNWVLQNYA-DFLADPVCAILNSSFAEQKLPPSWKD 482 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 614 HVRCPGAVTCPENEPRPIVALDT 682 H RCP N+P P+V +DT Sbjct: 1724 HHRCPSDPALSHNDPAPLVEIDT 1746 >SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16) Length = 814 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 614 HVRCPGAVTCPENEPRPIVALDT 682 H RCP N+P P+V +DT Sbjct: 378 HHRCPSDPALSHNDPAPLVEIDT 400 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,852,685 Number of Sequences: 59808 Number of extensions: 483086 Number of successful extensions: 1363 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1361 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -