BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0565 (762 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 24 1.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.1 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 9.4 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 9.4 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 9.4 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 743 AALGEDLHEVVCEVTTGPSPDAGWR 669 A +G+++ E+ C+VT P P WR Sbjct: 322 ARVGDNV-EIKCDVTGTPPPPLVWR 345 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 431 LRVAPEEHPVLLTEAPLNPKANREKM 508 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 634 VGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 542 VGD +A ++ D G + E+G G G Sbjct: 42 VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 103 IKRPAVTANREKQIPIAGR 47 IK P + ANR K IAG+ Sbjct: 284 IKLPKLAANRAKLEEIAGK 302 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 194 GMCKAGFAGD 223 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 238,731 Number of Sequences: 438 Number of extensions: 5867 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -