BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0563 (354 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.04c |mdm31||mitochondrial inner membrane protein Mdm31|S... 27 1.1 SPCC622.16c |epe1||Jmjc domain chromatin associated protein Epe1... 26 2.0 SPCC1183.11 ||SPCC31H12.01|MS ion channel protein 1|Schizosaccha... 25 4.5 SPBC8D2.06 |||isoleucine-tRNA ligase |Schizosaccharomyces pombe|... 24 6.0 >SPAC3H1.04c |mdm31||mitochondrial inner membrane protein Mdm31|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 26.6 bits (56), Expect = 1.1 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = -3 Query: 226 RPLQIEPLSSLTSWYLRFYLIWCISFTPEF 137 +PL ++ +++ SW+L +++W + T F Sbjct: 125 KPLTVDNVTAFFSWWLVSHIVWIVVGTTTF 154 >SPCC622.16c |epe1||Jmjc domain chromatin associated protein Epe1|Schizosaccharomyces pombe|chr 3|||Manual Length = 948 Score = 25.8 bits (54), Expect = 2.0 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = -3 Query: 346 SIDKLPASQQRSSWSGNRVEAIPVQLLSALWT*G*SPYTARPLQIEPLSSLTSWYLRFYL 167 SID +S++ SW GN ++ P+ S L +P P P+S T + YL Sbjct: 43 SIDSFISSKEEISWCGN--QSTPIATKSHLSC--INPQYVNPFDTSPVSVDTE-FQDTYL 97 Query: 166 IWCISFT-PEFSRQ 128 + SF P FS + Sbjct: 98 LDAPSFAQPHFSER 111 >SPCC1183.11 ||SPCC31H12.01|MS ion channel protein 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1011 Score = 24.6 bits (51), Expect = 4.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 244 ILTSIALTTAGLGWLLRGS 300 +LTS T GL WL GS Sbjct: 623 VLTSAGTTLLGLSWLFSGS 641 >SPBC8D2.06 |||isoleucine-tRNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1064 Score = 24.2 bits (50), Expect = 6.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 235 YTARPLQIEPLSSLTSWYLRF 173 YT P + + +T+WY+RF Sbjct: 713 YTVVPQLLGLIEEMTNWYIRF 733 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,464,527 Number of Sequences: 5004 Number of extensions: 27805 Number of successful extensions: 62 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 105935336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -