BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0562 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 5.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.1 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 8.9 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 8.9 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 385 LRVAPEEHPVLLTEAPLNPKANREKM 462 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/34 (35%), Positives = 12/34 (35%), Gaps = 1/34 (2%) Frame = +3 Query: 615 TP-PRHPASGLNRSRPHRLPHEDPHRARLLVHYH 713 TP P H G S H PH A H H Sbjct: 411 TPGPHHHTMGHGHSHIHATPHHHHSHAATPHHQH 444 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +3 Query: 528 AVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHP 632 ++ +++HR C P +L +I + P HP Sbjct: 62 SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHP 96 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 588 VGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 496 VGD +A ++ D G + E+G G G Sbjct: 42 VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 148 GMCKAGFAGD 177 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,606 Number of Sequences: 438 Number of extensions: 5556 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -