BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0556 (439 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 1.2 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 1.2 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 23 6.3 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 23 6.3 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 22 8.3 AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical prote... 22 8.3 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.0 bits (52), Expect = 1.2 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -2 Query: 432 TASGKLQSAVSEHQSPTRPGFDGSVTPPLSSAEPSGARPSARTTASEAS 286 TAS S+ S SP + S P SS S RP +T++ +S Sbjct: 9 TASSSTTSSSSSKPSPQQQQQLHSADVPHSSTSQSSRRPQHSSTSASSS 57 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 25.0 bits (52), Expect = 1.2 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -2 Query: 432 TASGKLQSAVSEHQSPTRPGFDGSVTPPLSSAEPSGARPSARTTASEAS 286 TAS S+ S SP + S P SS S RP +T++ +S Sbjct: 9 TASSSTTSSSSSKPSPQQQQQLHSADVPHSSTSQSSRRPQHSSTSASSS 57 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 22.6 bits (46), Expect = 6.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 106 REFDTCCRGE*GSILQGT 159 +EF C G+ G ++QGT Sbjct: 140 KEFLACSGGQGGGVIQGT 157 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 22.6 bits (46), Expect = 6.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 106 REFDTCCRGE*GSILQGT 159 +EF C G+ G ++QGT Sbjct: 171 KEFLACSGGQGGGVIQGT 188 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.2 bits (45), Expect = 8.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 228 TGSKGARHAGRALQVGGG 281 +G G++H G ++ GGG Sbjct: 2047 SGDNGSQHGGGSISGGGG 2064 >AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical protein protein. Length = 104 Score = 22.2 bits (45), Expect = 8.3 Identities = 9/19 (47%), Positives = 10/19 (52%), Gaps = 1/19 (5%) Frame = -1 Query: 139 LIPLCN-MCQTPAPRPPNH 86 L LC+ C P P PP H Sbjct: 16 LATLCHGACDEPCPVPPKH 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 461,635 Number of Sequences: 2352 Number of extensions: 8547 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -