BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0554 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 6.1 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 24 6.1 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 6.1 Identities = 17/77 (22%), Positives = 35/77 (45%) Frame = +3 Query: 543 FFSFFQGVIITILVYCGVLKTIFDISDTDTVKIISSKLQDFLICIEMVSGGDSASL*FLV 722 +F +F + TI + ++ F D + + L ++C+ ++S S+ ++ Sbjct: 891 YFDYFFTSVFTIELLLKLVSYGFLFHDGAFCRSAFNLLDLLVVCVSLISMFFSSGAISVI 950 Query: 723 QALRVAIGTRRLRVLAR 773 + LRV R LR + R Sbjct: 951 KILRVLRVLRPLRAINR 967 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 23.8 bits (49), Expect = 6.1 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -3 Query: 469 KSTKQYIATNCDRL 428 ++TKQY+AT+C L Sbjct: 201 EATKQYVATHCPHL 214 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 818,412 Number of Sequences: 2352 Number of extensions: 16140 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -