BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0550 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 1.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.4 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 5.5 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 9.7 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -3 Query: 179 DAICSVYCALYLSHNVIRFCIYSGHGFISETAL 81 DA+ SVY +L + + F IY+ ++ + Sbjct: 66 DALKSVYASLLCTEKIFLFAIYTNLSILTTVTI 98 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVFQALASTVFPSGNVTTTLISGLDAICSVY 159 V+ Q++ S FP L+SGL A+C +Y Sbjct: 155 VMIQSV-SFAFPINLSVPVLLSGLIAMCGMY 184 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVFQALASTVFPSGNVTTTLISGLDAICSVY 159 V+ Q++ S FP L+SGL A+C +Y Sbjct: 388 VMIQSV-SFAFPINLSVPVLLSGLIAMCGMY 417 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 251 VVFQALASTVFPSGNVTTTLISGLDAICSVY 159 V+ Q++ S FP L+SGL A+C +Y Sbjct: 388 VMIQSV-SFAFPINLSVPVLLSGLIAMCGMY 417 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 523 KGISSTDFNVLEGLIKKIAKEKQPFERLE-LTKEQLLEM 636 +GI T + L + EK+ FERL L ++LL++ Sbjct: 222 RGIPDTSKQLAAALGMQTTNEKEIFERLSVLPVDKLLQI 260 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 523 KGISSTDFNVLEGLIKKIAKEKQPFERLEL 612 +GI T + L + EK+ FERL + Sbjct: 224 RGIPDTSKQLAAALGMQTTNEKEIFERLSI 253 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,846 Number of Sequences: 336 Number of extensions: 3479 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -