SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0550
         (700 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       22   4.9  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    21   8.5  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    21   8.5  
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    21   8.5  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 14/42 (33%), Positives = 17/42 (40%)
 Frame = +1

Query: 217 GKTVEAKAWKTTPYDVAKGISQGLADATIIARVNNELWDLDR 342
           GKTV     K   Y    G S G     II   NN+ W + +
Sbjct: 6   GKTVSYTNKKDESYFDEGGRSYGKGRGFIIQNNNNDDWSVGK 47


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 448 RVYGGCLCYGPPI 486
           R  G CL +GPP+
Sbjct: 429 RFGGSCLIHGPPL 441


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 448 RVYGGCLCYGPPI 486
           R  G CL +GPP+
Sbjct: 429 RFGGSCLIHGPPL 441


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 520 EKGISSTDFNVLEGLIKKIAKE 585
           +KG+S   +NV+  LI  I KE
Sbjct: 551 KKGVSLRFYNVVYKLIDNIKKE 572


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,274
Number of Sequences: 438
Number of extensions: 3881
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -