BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0547 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 25 0.79 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 2.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 7.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.4 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 9.7 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 24.6 bits (51), Expect = 0.79 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +1 Query: 10 YHIIMSFDNDELRDEYPDGTVRLRNPNIEL 99 YHI + +++E RD++ ++L N +E+ Sbjct: 172 YHIKIDREDEEARDDFIKLGIKLSNDKLEI 201 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 301 ILHV*SWPGTFYKSRYGH 354 IL V + P FY+SRY H Sbjct: 10 ILAVSAAPAEFYESRYDH 27 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 229 CVCELFHAFRCSAHAHKLDVSKHLNK 152 C+CEL+ AF + LD +++ Sbjct: 315 CLCELYMAFMDRLYFSNLDKDAFIHR 340 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 652 VRAHCFAGHGVVGVFGIGQCFQLP 581 V AH G G +G +G + +P Sbjct: 189 VEAHLRKGRGAIGAYGPEKSASIP 212 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +1 Query: 70 VRLRNPNIELMDQDILYHLALGSGL 144 +R NP L L+H+ +G L Sbjct: 659 LRANNPGFWLFHCHFLFHIVIGMNL 683 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,409 Number of Sequences: 336 Number of extensions: 4081 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -