BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0547 (702 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 25 0.70 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.2 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 24 1.6 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 24 1.6 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 1.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 1.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 1.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 1.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 1.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 1.6 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 1.6 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 1.6 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 1.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 1.6 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 1.6 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 24 1.6 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 2.1 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 2.1 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 2.1 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 2.1 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.1 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.1 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 2.8 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 2.8 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 2.8 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 2.8 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 2.8 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 2.8 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.0 bits (52), Expect = 0.70 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ R Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQRSYKNENSYRKYR 293 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSCSREREQKSYKNENSYRKYR 293 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 246 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 282 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 246 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 282 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 262 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 298 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 527 SVLEHSSGLHRRLHRK*QPYR 465 SV E+ S +HRR+H K +PY+ Sbjct: 130 SVKENLS-VHRRIHTKERPYK 149 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 60 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 60 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 60 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 60 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKKKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 293 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -3 Query: 433 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 323 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,706 Number of Sequences: 438 Number of extensions: 4514 Number of successful extensions: 33 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -