BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0540 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 25 2.1 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 25 2.8 DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 23 8.4 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 25.0 bits (52), Expect = 2.1 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +2 Query: 152 LHFYMMVGLIPAGALIFYCNVFIGPAQLT----PIPEGYTPK 265 L +YM LI + +CN LT P+PEGY PK Sbjct: 232 LFYYMHQQLIARYNVERFCNRLARVRPLTNLREPLPEGYFPK 273 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 24.6 bits (51), Expect = 2.8 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +2 Query: 152 LHFYMMVGLIPAGALIFYCNVFIGPAQLT----PIPEGYTPK 265 L +YM LI + +CN LT P+PEGY PK Sbjct: 233 LFYYMHQQLIARYNVDRFCNRLSRVRPLTSLREPLPEGYFPK 274 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 23.0 bits (47), Expect = 8.4 Identities = 17/78 (21%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = +2 Query: 146 DMLHFYMMVGLIPAGALIFYCNVFIGPAQL-TPIPEGYTPKYWEYHRHPITRFIARYIHN 322 D LH + G I +C + + + P P TP +E+H + F+ R + Sbjct: 314 DDLHVFHDSGRTRLNGFIQHCYLAVSESGSGIPAPPD-TPSEFEFHANRPFMFLIRRTMD 372 Query: 323 NPQQDYEKFMHFLDEEQQ 376 F ++D ++Q Sbjct: 373 GNVLQVGNFSKYIDPDEQ 390 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,093 Number of Sequences: 2352 Number of extensions: 15781 Number of successful extensions: 69 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -