BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0539 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 24 1.5 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 24 1.5 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 278 QKGQEF*VGHEHKLCAI-GKETLQSQERS**YDKLQVGD 391 +KG+ H+ KLCA+ G E L+ ++ +DK + GD Sbjct: 17 RKGKNASQAHK-KLCAVYGDEALKERQCQNWFDKFRSGD 54 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 117 QKRGNGAVAWSKPRLKR-AN*GIIKY 191 Q G V W PR KR N GII + Sbjct: 346 QMDSGGPVLWQNPRTKRLVNIGIISW 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,961 Number of Sequences: 438 Number of extensions: 3779 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -