BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0529 (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 24 1.5 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 22 4.7 AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 21 8.1 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 21 8.1 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 23.8 bits (49), Expect = 1.5 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = -3 Query: 321 ESAASTAPPPGTSLPDSSTRRTAHSASCADRSISSQYASVGPRRISDAAV---RAAGP 157 E AA++ PP TS+P++S R S A + ++ R +S ++ RA GP Sbjct: 84 EYAANSQPPRITSVPNTS-RLDKSEISLATKQACGFIDNIDKRNLSVTSMIQKRALGP 140 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 444 VASRAALTANVFGITRRDCANAAIANCSRELRVVA 340 +AS+ ALT T DC + +A C ++V++ Sbjct: 162 LASKCALT------TLTDCLRSELAQCESNIKVIS 190 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +2 Query: 449 LVAKLRAYHNSSQTKVEHANLKWVGLDLTEGTLRDNLAAGVLE 577 L+ + + QTK E NLK V L++ L V E Sbjct: 110 LIGLVERHKKRGQTKEEFQNLKEVMLEVLRQALGKQYTPEVAE 152 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +2 Query: 449 LVAKLRAYHNSSQTKVEHANLKWVGLDLTEGTLRDNLAAGVLE 577 L+ + + QTK E NLK V L++ L V E Sbjct: 110 LIGLVERHKKRGQTKEEFQNLKEVMLEVLRQALGKQYTPEVAE 152 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,047 Number of Sequences: 438 Number of extensions: 2681 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -