BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0526 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 4.5 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.9 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.9 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 7.8 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +2 Query: 548 VFTQKKIYILYYYLNECSVRI 610 +FT K+ ++Y + ECS+ + Sbjct: 138 IFTSGKLKEMFYLIIECSLNL 158 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 101 TKNLEAGQQLVKRTMDELIQQKQTTEKV 184 T+NLE +++T EL +KQ T+++ Sbjct: 356 TRNLELLTDKLQQTYRELDGEKQKTDRL 383 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 101 TKNLEAGQQLVKRTMDELIQQKQTTEKV 184 T+NLE +++T EL +KQ T+++ Sbjct: 356 TRNLELLTDKLQQTYRELDGEKQKTDRL 383 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 7.8 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -2 Query: 487 KHSMNHSMNFPSKRCLVCRLGVERQLSRLICAVG*SLNL 371 KHS H++ P+K + + G SRL G +NL Sbjct: 96 KHSYLHTITSPNKFVRLYQDGRVLYSSRLTIKAGCPMNL 134 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,789 Number of Sequences: 438 Number of extensions: 2194 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -