Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0525
         (347 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    21   3.6  
AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450 ...    21   4.8  
AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450 ...    21   4.8  
X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       20   6.3  

>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 21.0 bits (42), Expect = 3.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 73  NVLERGLFC 47
           N +ERGLFC
Sbjct: 128 NCIERGLFC 136


>AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 505

 Score = 20.6 bits (41), Expect = 4.8
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -2

Query: 214 LCSIVVCWFLSKC 176
           L  ++ CW +SKC
Sbjct: 218 LYRLLRCWLISKC 230


>AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 protein.
          Length = 505

 Score = 20.6 bits (41), Expect = 4.8
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -2

Query: 214 LCSIVVCWFLSKC 176
           L  ++ CW +SKC
Sbjct: 218 LYRLLRCWLISKC 230


>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 20.2 bits (40), Expect = 6.3
 Identities = 10/33 (30%), Positives = 16/33 (48%)
 Frame = +3

Query: 147 KLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKK 245
           K+D +Q+     D+   TT+   V+  Q   KK
Sbjct: 424 KVDPTQVESEEEDEETSTTVFSNVEVVQEEAKK 456


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 72,226
Number of Sequences: 336
Number of extensions: 1317
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used:  6876025
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)