BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0522 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 4.2 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 4.2 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 22 5.5 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 283 LLLDVSPTKFVFLAQTPFVKVIDLEGTVDV 372 + L + T F FLA+ +K D+ VDV Sbjct: 99 MALTLIVTLFTFLARGTLIKSFDMLSHVDV 128 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 283 LLLDVSPTKFVFLAQTPFVKVIDLEGTVDV 372 + L + T F FLA+ +K D+ VDV Sbjct: 99 MALTLIVTLFTFLARGTLIKSFDMLSHVDV 128 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 52 DKKKQGHKTSVRYL 93 DK+KQG KT +++L Sbjct: 79 DKQKQGAKTVIQHL 92 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.135 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,651 Number of Sequences: 336 Number of extensions: 3688 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -