BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0522 (697 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ414022-1|CAC88750.1| 122|Homo sapiens immunoglobulin heavy ch... 33 1.3 DQ100806-1|AAZ08813.1| 122|Homo sapiens immunoglobulin heavy ch... 31 3.9 BC036375-1|AAH36375.1| 739|Homo sapiens angiotensin I convertin... 31 5.2 >AJ414022-1|CAC88750.1| 122|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 122 Score = 32.7 bits (71), Expect = 1.3 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 352 LEGTVDVQSKAKTQQAKLRFKLLEGKEVSVQALAKDFQYFEFTTGYL 492 L+G V + + T A + + L + +V A+D Y++F +GYL Sbjct: 64 LQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDDSYYDFWSGYL 110 >DQ100806-1|AAZ08813.1| 122|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 122 Score = 31.1 bits (67), Expect = 3.9 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 352 LEGTVDVQSKAKTQQAKLRFKLLEGKEVSVQALAKDFQYFEFTTGYL 492 L+G V + + T A + + L + +V A++ +Y++F +GYL Sbjct: 64 LQGRVTMTTDTSTSTAYMELRNLRSDDTAVYYCAREDRYYDFWSGYL 110 >BC036375-1|AAH36375.1| 739|Homo sapiens angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 protein. Length = 739 Score = 30.7 bits (66), Expect = 5.2 Identities = 20/79 (25%), Positives = 36/79 (45%) Frame = -3 Query: 449 RAWTLTSLPSRSLNLNLACWVFALLCTSTVPSKSITFTNGVWAKKTNLVGETSNNSLETR 270 + W LPS L L C+ LL S S+ +T T+G ++ T +T+ + Sbjct: 3 QGWATAGLPS--LLFLLLCYGHPLLVPSQEASQQVTVTHGTSSQATT-SSQTTTHQATAH 59 Query: 269 SAPREE*HRLTDDSRIYRF 213 A + + +TD++ +F Sbjct: 60 QASAQSPNLVTDEAEASKF 78 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.135 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,812,427 Number of Sequences: 237096 Number of extensions: 2300879 Number of successful extensions: 5130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5130 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -