BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0519 (706 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03260.1 68416.m00322 homeobox-leucine zipper family protein ... 28 6.9 At1g14610.1 68414.m01737 valyl-tRNA synthetase / valine--tRNA li... 28 6.9 >At3g03260.1 68416.m00322 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to L1 specific homeobox gene ATML1/ovule-specific homeobox protein A20, GB:CAB36819 Length = 699 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 486 AMVDQIQSS*CPACANPP 433 AM+D ++S CPAC PP Sbjct: 103 AMLDALKSVLCPACGGPP 120 >At1g14610.1 68414.m01737 valyl-tRNA synthetase / valine--tRNA ligase (VALRS) nearly identical to SP|P93736 Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase) (ValRS) {Arabidopsis thaliana} Length = 1108 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = +3 Query: 81 IVLSSDIEALLGMGSSVILAGDLNCKHVRWNSHTTTPNGRRLDALVDDLAFDI-----VA 245 IV ++ +E +LG + I D KH+ NGR+L + D + D Sbjct: 363 IVATTRVETMLGDTAIAIHPDDARYKHLHGKFAVHPFNGRKLPIICDGILVDPNFGTGCV 422 Query: 246 PLTPTHYP 269 +TP H P Sbjct: 423 KITPAHDP 430 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,299,823 Number of Sequences: 28952 Number of extensions: 272701 Number of successful extensions: 655 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -