BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0511 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38764| Best HMM Match : CBM_14 (HMM E-Value=1.5e-10) 36 0.029 SB_19839| Best HMM Match : Ery_res_leader2 (HMM E-Value=9.9) 34 0.12 SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) 33 0.20 SB_58496| Best HMM Match : Ferritin (HMM E-Value=0.0012) 33 0.27 SB_21296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_12078| Best HMM Match : Ubie_methyltran (HMM E-Value=0.17) 28 5.7 SB_18191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_10903| Best HMM Match : Aldolase_II (HMM E-Value=9.1e-17) 28 7.6 SB_39606| Best HMM Match : DUF164 (HMM E-Value=0.47) 28 7.6 >SB_38764| Best HMM Match : CBM_14 (HMM E-Value=1.5e-10) Length = 155 Score = 35.9 bits (79), Expect = 0.029 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +2 Query: 191 IASNMKVYALIVACLALGVLAEEDSCYQNVDQGCRRTLSLPHCSAYYGQFKDNH 352 ++S+MK L++AC ++ E+D C + D GC + L CS YY Q D H Sbjct: 46 MSSDMKSLVLLIACFSVARATEDDFCKER-DAGC--YVDLKDCSKYY-QCDDFH 95 >SB_19839| Best HMM Match : Ery_res_leader2 (HMM E-Value=9.9) Length = 117 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +1 Query: 211 VCSHRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVLR 333 V SH LSG GC G+GR + E++ R +A LQ +LR Sbjct: 56 VWSHLHLSGGGC-GKGRHLPKEKQSRGSPPISAALLQHILR 95 >SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) Length = 339 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +2 Query: 203 MKVYALIVACLALGVLAEEDSCYQNVDQGCRRTLSLPHCSAYYGQFKDNH 352 MK L++AC ++ E+D C + D GC + L CS YY Q D H Sbjct: 1 MKSLVLLIACFSVARATEDDYCKER-DAGC--YVDLKDCSKYY-QCDDFH 46 >SB_58496| Best HMM Match : Ferritin (HMM E-Value=0.0012) Length = 126 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 404 YHYLLSASYFNNYQTNREGFAKLFRKLSDDSWE 502 Y YL A +F+ N GF K F+K S + WE Sbjct: 50 YTYLSMAFHFDRDDINLPGFNKFFKKASKEEWE 82 >SB_21296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/43 (25%), Positives = 24/43 (55%) Frame = +2 Query: 422 ASYFNNYQTNREGFAKLFRKLSDDSWEKTIGLIKHVTKRGGKM 550 A++F + GFA F+K +++ + ++ + KRGG++ Sbjct: 1 AAHFGRDDIHLPGFAAFFKKAAEEEYTHAHMFMEFLNKRGGRV 43 >SB_12078| Best HMM Match : Ubie_methyltran (HMM E-Value=0.17) Length = 237 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 488 DDSWEKTIGLIKHVTKRGGKMDFSSHTTLKGD 583 +DS ++ +G +K V K GG+ F H K D Sbjct: 160 EDSLDQLLGEVKRVLKPGGRFYFIEHIADKSD 191 >SB_18191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 380 ASLYLKRSYHYLLSASYFNNYQTNREGFAKLFRKLSDD 493 +++ L HYL S + F NYQ +G LF++ D+ Sbjct: 326 STILLNAGLHYLESTN-FTNYQRLIDGIVLLFKRAKDE 362 >SB_10903| Best HMM Match : Aldolase_II (HMM E-Value=9.1e-17) Length = 280 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 202 YEGVCSHRCLSGSGCAGRGRLML 270 +EGVC+H + G G GR+ML Sbjct: 63 HEGVCNHLSMMAPGKHGTGRVML 85 >SB_39606| Best HMM Match : DUF164 (HMM E-Value=0.47) Length = 626 Score = 27.9 bits (59), Expect = 7.6 Identities = 21/82 (25%), Positives = 34/82 (41%) Frame = +1 Query: 304 KSAALQRVLRPIQGQPRCSERTEGISLTVFETFLPLSPVGLLLQQLPDEQGRIREALQEI 483 +S + R PI G+ R G + + PLSP ++ D R R LQ + Sbjct: 119 RSKSPVRSTSPILGRSSSPSRRGGSPSRILNSS-PLSPSKQVVDGDNDTVQRQRRELQLL 177 Query: 484 IGRFVGENHWSHKARH*EGWED 549 IG + +SH + W++ Sbjct: 178 IGELKDRDRFSHWKKDVRDWKE 199 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,593,181 Number of Sequences: 59808 Number of extensions: 378397 Number of successful extensions: 949 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 949 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -