BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0510 (731 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.3 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 5.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.2 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 481 STPFFFKGI*DLVTKTFRSSLILIFMKTF 567 S PF ++GI L K RSS ++ F++ F Sbjct: 536 SKPFKYQGITILEKKPSRSSTLVSFLQPF 564 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 5.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 96 VTLKISLQLNCTVFLDLPTDIIWFSLCLVP 185 V+L IS+ L+ TVF L +II + +VP Sbjct: 272 VSLSISILLSLTVFFLLLAEIIPPTSLVVP 301 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 72 RYYCIQNDVTLKISLQLNCTVFLDLPTDII 161 RYY Q + K+ Q F+D+P DII Sbjct: 519 RYY-YQRGILAKVDGQRLVYQFVDVPKDII 547 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,638 Number of Sequences: 438 Number of extensions: 3748 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -