BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0509 (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32360.1 68417.m04607 NADP adrenodoxin-like ferredoxin reduct... 28 5.3 At2g42470.1 68415.m05254 meprin and TRAF homology domain-contain... 27 9.3 >At4g32360.1 68417.m04607 NADP adrenodoxin-like ferredoxin reductase identical to NADP adrenodoxin-like ferredoxin reductase GI:28192433 from [Arabidopsis thaliana] Length = 483 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 248 LRSGISPEHESENVNIKNFAHMKIHWSC*FM 340 +RSG++P+H + I F+ + H C F+ Sbjct: 62 VRSGVAPDHPETKIAINQFSRVAQHERCSFI 92 >At2g42470.1 68415.m05254 meprin and TRAF homology domain-containing protein / MATH domain-containing protein contains Pfam profile PF00917: MATH domain Length = 898 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 95 RQYAPNDTQYIVVSGPSYIAATYGWLRLTKYTKILLS 205 R + D + +S P+ + YGW R TKY+ I+L+ Sbjct: 62 RVWQIEDHLAVTLSVPNLESLRYGWERRTKYSFIVLN 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,544,752 Number of Sequences: 28952 Number of extensions: 285285 Number of successful extensions: 542 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -