BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0502 (479 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0321 + 24091997-24092530 31 0.64 12_02_1069 + 25801309-25801433,25802429-25802620,25803130-258031... 29 2.6 07_03_1293 - 25563431-25563545,25564078-25564196,25564300-255644... 25 4.0 >05_05_0321 + 24091997-24092530 Length = 177 Score = 30.7 bits (66), Expect = 0.64 Identities = 16/56 (28%), Positives = 30/56 (53%) Frame = +2 Query: 110 SARQGSEKQNA*SRPRRRLKMKLKSTDRSVKGSSKNLKPSTWVPGKVLRPRSMPRP 277 ++R+ ++Q A + RRL+ + + S GS + + +VPG + R + PRP Sbjct: 97 ASRRQQQQQAAAAARERRLRRRRSDSRGSCGGSGDGVLLNFYVPGLLTRSMTTPRP 152 >12_02_1069 + 25801309-25801433,25802429-25802620,25803130-25803159, 25803426-25803500,25803599-25804373,25804549-25804614, 25804746-25804811,25804898-25805140,25805407-25805502 Length = 555 Score = 28.7 bits (61), Expect = 2.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 190 VCTFQLHLEPPPWPALGVLLFASL 119 V FQ + PPPWPA G F + Sbjct: 231 VAAFQSRMMPPPWPARGKAEFGDV 254 >07_03_1293 - 25563431-25563545,25564078-25564196,25564300-25564467, 25564565-25564627,25564709-25564816,25565125-25565237, 25565313-25565609,25565724-25565802,25566116-25566224, 25566324-25566365,25567023-25567153,25568100-25568648 Length = 630 Score = 24.6 bits (51), Expect(2) = 4.0 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 303 FVHLFDLNFGLGIDLGRNTFPGTHVLGFKFFELP 202 F+ L G+ LG N + H GFK+F P Sbjct: 580 FLGFVKLLHGMSSRLGYNDWAHIHSFGFKYFLQP 613 Score = 21.8 bits (44), Expect(2) = 4.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 108 FLRSAFFSSRSCWI 67 FL+ + FSSR WI Sbjct: 610 FLQPSIFSSRKLWI 623 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,525,273 Number of Sequences: 37544 Number of extensions: 181064 Number of successful extensions: 536 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -