BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0501 (688 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92812-7|CAB07281.2| 341|Caenorhabditis elegans Hypothetical pr... 29 2.4 U53344-6|AAK77632.2| 702|Caenorhabditis elegans Hypothetical pr... 29 2.4 >Z92812-7|CAB07281.2| 341|Caenorhabditis elegans Hypothetical protein T03E6.8 protein. Length = 341 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/64 (26%), Positives = 35/64 (54%) Frame = +3 Query: 282 SFVMCLTLKFFSRI*TLC*IINLKASFTFHSL*ESCIKIRLLIKEKTIISSIYDL*V*LL 461 S + CL + + SR + L+ +FTF + ++C+ + L+I I+S+++ + +L Sbjct: 225 SVLTCLKIVYDSRKIVSRETLTLQRNFTFILMYQACVCVALIIVPLAIVSTLFYADISIL 284 Query: 462 KNML 473 N L Sbjct: 285 DNGL 288 >U53344-6|AAK77632.2| 702|Caenorhabditis elegans Hypothetical protein T07H6.1a protein. Length = 702 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 590 KGIYFYVLNYKLK*FCFINSKFWDKSVGSYYVW 492 KGI F +NY+L F+N + DK G++ +W Sbjct: 159 KGIAFVSINYRLGPLGFMNYQNGDKLEGNFGIW 191 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,538,799 Number of Sequences: 27780 Number of extensions: 235462 Number of successful extensions: 308 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -