BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0498 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0535 + 4234282-4235082 29 3.4 06_01_1088 - 8926361-8927301,8927437-8927705,8927850-8929023,892... 29 3.4 >11_01_0535 + 4234282-4235082 Length = 266 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -2 Query: 654 TKSRSLHTLNINFIIWNSVYLHYTHAKLVHGLKLNRM 544 T S S TL + + LHY H LVH L+L R+ Sbjct: 74 TTSLSTPTLRVTILPAALYMLHYVHRTLVHPLRLLRL 110 >06_01_1088 - 8926361-8927301,8927437-8927705,8927850-8929023, 8929132-8929399 Length = 883 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 3/69 (4%) Frame = +3 Query: 120 DTNKLNCV-FAWTFHVPETFFLSYPPIVVTSRGHTTHTIFTERVGELTGL*LMDV--ANT 290 D NKL+ + F F+V T+F I+ S T E +GEL L +D+ + Sbjct: 513 DLNKLHSLRFGINFNVEITWFNQLSNILYLSLKGCTVVKLPESIGELNSLRYLDISYSGC 572 Query: 291 SPRKSRVTQ 317 SP+ S +++ Sbjct: 573 SPKLSEISR 581 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,973,606 Number of Sequences: 37544 Number of extensions: 309804 Number of successful extensions: 703 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -