BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0498 (676 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z50044-5|CAA90357.2| 332|Caenorhabditis elegans Hypothetical pr... 27 9.2 U40938-6|AAA81698.1| 655|Caenorhabditis elegans Hypothetical pr... 27 9.2 >Z50044-5|CAA90357.2| 332|Caenorhabditis elegans Hypothetical protein F22B5.5 protein. Length = 332 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 309 VTQNLPPHRKRDPLRRSDEKFSGLCLWVRP 398 + Q+LP +D L R +KF W+RP Sbjct: 263 IIQDLPMKDLKDVLVRCSDKFEDSATWIRP 292 >U40938-6|AAA81698.1| 655|Caenorhabditis elegans Hypothetical protein D1009.1a protein. Length = 655 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = -2 Query: 534 IPDNDTFV---FTIIVLILYNSKTVFWK 460 +PD+ F F + ++LYN +VFWK Sbjct: 4 MPDSPKFALVTFVVYAVVLYNVNSVFWK 31 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,370,577 Number of Sequences: 27780 Number of extensions: 289058 Number of successful extensions: 614 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -