Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0497
         (347 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot...    21   4.2  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    21   4.2  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    21   5.5  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    21   5.5  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    20   9.6  

>EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein
           protein.
          Length = 1010

 Score = 21.0 bits (42), Expect = 4.2
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = -3

Query: 318 LSSLGVSNSTWNQTKHYSNRIIVPLTAAVVVFARIQ 211
           L +LG S    + +  Y N IIV   A  V    +Q
Sbjct: 52  LQNLGASYDIESNSHQYKNPIIVMYYAGAVKAGLVQ 87


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.0 bits (42), Expect = 4.2
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -3

Query: 129 YKSRCNVDIE 100
           YKS C++D+E
Sbjct: 149 YKSSCSIDVE 158


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 20.6 bits (41), Expect = 5.5
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -3

Query: 129 YKSRCNVDIE 100
           YKS C +D+E
Sbjct: 149 YKSSCEIDVE 158


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 20.6 bits (41), Expect = 5.5
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -3

Query: 129 YKSRCNVDIE 100
           YKS C +D+E
Sbjct: 145 YKSSCEIDVE 154


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 19.8 bits (39), Expect = 9.6
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -3

Query: 129 YKSRCNVDIE 100
           YKS C +D+E
Sbjct: 141 YKSFCEIDVE 150


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,100
Number of Sequences: 438
Number of extensions: 1950
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  7936320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)