BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0492 (668 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.09 |sre1||sterol regulatory element binding protein Sre... 27 1.8 SPAC6C3.06c |||P-type ATPase, calcium transporting|Schizosacchar... 25 9.9 >SPBC19C2.09 |sre1||sterol regulatory element binding protein Sre1|Schizosaccharomyces pombe|chr 2|||Manual Length = 900 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 62 KGPNKVGFIGLLQPLSDAIKLFTKERTYPNFSNYFC 169 K PN VG I PL+ + K T N SN C Sbjct: 28 KSPNSVGAIPSSSPLASSTKASTSTPFVENCSNLLC 63 >SPAC6C3.06c |||P-type ATPase, calcium transporting|Schizosaccharomyces pombe|chr 1|||Manual Length = 1033 Score = 25.0 bits (52), Expect = 9.9 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -3 Query: 663 LINKILEYSAKKIKANPHLLYSILNPETNSL--SPSAKSKGVRFVSA 529 ++NK S + +N H LYS+ ET SL S A + G+ S+ Sbjct: 30 VLNKSFRSSRQSSVSNGHGLYSLDRDETESLMSSHEASNAGISLDSS 76 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,534,514 Number of Sequences: 5004 Number of extensions: 21852 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -