BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0491 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17503| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 4e-24 SB_56402| Best HMM Match : Extensin_2 (HMM E-Value=1.1) 28 6.5 >SB_17503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 108 bits (260), Expect = 4e-24 Identities = 52/61 (85%), Positives = 57/61 (93%) Frame = +1 Query: 4 AVKLLVELASLQTSFVTLDEVIKITNRRVNAIEHVIIPRLERTLAYIISELDELEREEFY 183 AVKLLVELASLQTSFVTLDE IK+TNRRVNAIEHVIIPR+E T++YI+ ELDE EREEFY Sbjct: 46 AVKLLVELASLQTSFVTLDEAIKLTNRRVNAIEHVIIPRIENTVSYILGELDEREREEFY 105 Query: 184 R 186 R Sbjct: 106 R 106 >SB_56402| Best HMM Match : Extensin_2 (HMM E-Value=1.1) Length = 352 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 349 VWSATYGLRTASPHRPHPASW*PRRASRCRQP 254 +W+ YG + PH +P W P + C +P Sbjct: 79 LWNPIYGTPSMEPHVWNPNLWNPMYGTPCMEP 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,580,358 Number of Sequences: 59808 Number of extensions: 273983 Number of successful extensions: 938 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -