BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0487 (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 24 1.3 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 5.1 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 9.0 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.8 bits (49), Expect = 1.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -1 Query: 242 CGLTRGPITSKQAVD-KSVITS*TSHRSAKCSLEARQSSYVGNKKQK 105 C L++GP Q VD K V+ AKC+ + R ++Y K+ K Sbjct: 46 CLLSKGPCPP-QGVDLKRVLPEALQTNCAKCTEKQRTAAYRSIKRLK 91 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +3 Query: 258 SSNSFRFERWGSRCNYTETLELISQCGWRI 347 + NS ++ Y E +EL + GW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 380 WLLEPIDIYNVNAPSTLRYK 321 WL P + N P +LR+K Sbjct: 7 WLTPPHSLGNTVTPVSLRFK 26 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,453 Number of Sequences: 336 Number of extensions: 3333 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -