BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0484 (558 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.09c |||Haemolysin-III family protein|Schizosaccharomyce... 27 1.4 SPCC1919.03c |||AMP-activated protein kinase beta subunit |Schiz... 25 10.0 >SPBC12C2.09c |||Haemolysin-III family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 324 Score = 27.5 bits (58), Expect = 1.4 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = -3 Query: 208 VLLASVCGLDRLRPSPWTP----SWVLSGVFFLPP 116 V++AS C LDR R W P +VL G+F + P Sbjct: 200 VIVASTCLLDRFRQPEWRPYRALIFVLMGLFGIFP 234 >SPCC1919.03c |||AMP-activated protein kinase beta subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 298 Score = 24.6 bits (51), Expect = 10.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 111 REGGKKKTPESTQEGVQGDGRRRSSPQTEAKR 206 +EGG +T ++ G G +RRS QT K+ Sbjct: 60 QEGGNNRTSQNGTSGSSGHTKRRS--QTSGKK 89 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,796,612 Number of Sequences: 5004 Number of extensions: 31128 Number of successful extensions: 64 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -