BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0484 (558 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0660 + 30687366-30687370,30687823-30688765,30688820-306889... 30 1.4 03_04_0024 + 16556026-16556588,16556757-16556868 29 2.5 03_01_0479 + 3671792-3671844,3671950-3675691,3675815-3675895,367... 29 2.5 11_01_0204 - 1612505-1612636,1612809-1612926,1613050-1613162,161... 29 3.3 03_01_0141 + 1116833-1117082,1117658-1118574,1119417-1119579,111... 28 4.4 >02_05_0660 + 30687366-30687370,30687823-30688765,30688820-30688971, 30689301-30689316,30690410-30690508,30690598-30690671, 30690827-30691076 Length = 512 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 Query: 187 GLDRLRPSPWTPSWVLSGVFFLPPSRPDMV 98 G RL PSP P +G +F PSRP+ V Sbjct: 10 GCPRLPPSPPLPQAPPAGYYFTSPSRPEAV 39 >03_04_0024 + 16556026-16556588,16556757-16556868 Length = 224 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 283 ISLFHPG*VDLFELPSPWLPEVPSVVLLASVCGLDRL-RPSPWTPSWV 143 + + H G V LP P P PSV + S + P PW PSW+ Sbjct: 47 VEVHHGGLVAPSPLPDP-PPPSPSVAAIFSFSSSSLIFPPPPWRPSWL 93 >03_01_0479 + 3671792-3671844,3671950-3675691,3675815-3675895, 3675973-3676042,3676157-3676224 Length = 1337 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = -2 Query: 524 ILLYFNKLKNIVIYVFTNADDIFERYHIKVC*QDSCLKKSSFCKHNNIHIVLNSQTRYKI 345 +L KL + VI + A ++ + I C QD CL S C +H+++ + + Sbjct: 220 VLADAGKLFSQVIQAYAEAGNLGKSISIYDCAQDRCLIPSGSCYQVLLHLLMERRKNDLV 279 Query: 344 LQLKL 330 L++ L Sbjct: 280 LRVYL 284 >11_01_0204 - 1612505-1612636,1612809-1612926,1613050-1613162, 1613640-1613712,1613797-1613936,1614059-1614129, 1614262-1614430,1614625-1614690,1615081-1615179, 1615298-1615471,1615745-1615823,1615929-1616035, 1616395-1616439 Length = 461 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 271 HPG*VDLFELPSPWLPEVPSVVLLASVCGLDRLRPS 164 H G DL EL W P++PS+++ + G + L PS Sbjct: 417 HQGQKDLKELH--WHPQIPSMIISTAADGFNMLMPS 450 >03_01_0141 + 1116833-1117082,1117658-1118574,1119417-1119579, 1119668-1120497,1120562-1120570 Length = 722 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 220 VPSVVLLASVCGLDRLRPSPWTPSWVLSGVF 128 +PSV VCG+ R+ PSP P VL G F Sbjct: 200 MPSVAASPVVCGMKRIDPSPSDP--VLKGRF 228 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,522,797 Number of Sequences: 37544 Number of extensions: 176989 Number of successful extensions: 468 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1269546012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -