Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0480
         (643 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276486-1|CAB90818.1|  364|Anopheles gambiae serine protease pr...    30   0.054

>AJ276486-1|CAB90818.1|  364|Anopheles gambiae serine protease
           protein.
          Length = 364

 Score = 30.3 bits (65), Expect = 0.054
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = -3

Query: 464 IGLPSVDAEAVGGDAVSAISGVGRGDSVRCGDAIGGSDQGRGEVGSP 324
           + LP ++ EA   ++V A++ V   D   C   + GSD  RG+ G P
Sbjct: 269 VELPGLEHEAC--NSVYAVANVTLSDKQLCIGGLNGSDSCRGDSGGP 313


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 374,359
Number of Sequences: 2352
Number of extensions: 5472
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63141405
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)