BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0473 (642 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08310.1 68417.m01372 expressed protein glutamic acid-rich pr... 33 0.16 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 32 0.37 At4g19230.2 68417.m02837 cytochrome P450 family protein cytochro... 31 0.49 At4g02710.1 68417.m00366 kinase interacting family protein simil... 31 0.86 At3g19900.1 68416.m02520 expressed protein 29 2.0 At5g17240.1 68418.m02020 SET domain-containing protein contains ... 29 2.6 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 29 3.5 At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-contai... 28 4.6 At5g64710.2 68418.m08135 expressed protein contains Pfam profile... 28 6.1 At5g64710.1 68418.m08134 expressed protein contains Pfam profile... 28 6.1 At3g04810.2 68416.m00521 protein kinase, putative similar to LST... 28 6.1 At3g04810.1 68416.m00520 protein kinase, putative similar to LST... 28 6.1 At1g57760.1 68414.m06553 expressed protein 28 6.1 At3g20860.1 68416.m02637 protein kinase family protein contains ... 27 8.0 At2g04230.1 68415.m00410 F-box family protein contains F-box dom... 27 8.0 At1g33670.1 68414.m04165 leucine-rich repeat family protein cont... 27 8.0 >At4g08310.1 68417.m01372 expressed protein glutamic acid-rich protein precursor - Plasmodium falciparum, PIR2:A54514 Length = 504 Score = 33.1 bits (72), Expect = 0.16 Identities = 22/59 (37%), Positives = 30/59 (50%) Frame = +1 Query: 85 DEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGK 261 D K +K+H CLA + DE N L+T + K + P+K+ A L K KDGK Sbjct: 77 DVHKSFVKQHLVQCLAGAENDETSENSLET-EKKDDVTPVKEAA--ELSKEHTTKKDGK 132 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 31.9 bits (69), Expect = 0.37 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = +1 Query: 118 ADCLAETKADE--QLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKV 291 A+ +AET E + LK + + N +K C+++ S+ F+K + L + Sbjct: 479 AEDIAETMDAEVVEAQKMLKLAEAQRMNTDSRKAIFCVIMSSEDYID--AFEKLLRL-DL 535 Query: 292 PNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 423 P +D+ + L++ CL K + T C H+K+ K L Sbjct: 536 PGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDKNHKFTL 579 >At4g19230.2 68417.m02837 cytochrome P450 family protein cytochrome P450, Arabidopsis thaliana; supported by cDNA: gi_15293092_gb_AY050980.1_ Length = 484 Score = 31.5 bits (68), Expect = 0.49 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 421 ERASGLSRGSISRNSRLFGEGCCLCWPGKRQS 326 ERA+G S G +SR C LCWPG R+S Sbjct: 439 ERATGFSMG----HSRFPKTDCPLCWPGSRRS 466 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 30.7 bits (66), Expect = 0.86 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 502 LDKHVRASYLTLMRYGTVGL-DYVFTRKERASGLSRGSISRNSRLFGEGCCL 350 ++K R+ + L+ L DYVFT +E A +S+G+ + L EG CL Sbjct: 760 IEKLKRSQTIVLLNESIKSLEDYVFTHRESAGEVSKGADLMDEFLKLEGMCL 811 >At3g19900.1 68416.m02520 expressed protein Length = 222 Score = 29.5 bits (63), Expect = 2.0 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -1 Query: 171 LQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKSLHD 28 L F H L + G+T F ++ ++ EG + DN+DDE +SL D Sbjct: 42 LAFSHSLCLKTTYGKTDRRKFSRICSIVDDEG-NLDNSDDEEKESLDD 88 >At5g17240.1 68418.m02020 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 491 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +1 Query: 202 LKKYALCMLI-KSQLMTKDGKFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 378 LKK L + + + LMT + KD+ L+ N + L +++ CL + + ++ W Sbjct: 57 LKKGELVLKVPRKALMTTESIIAKDLKLSDAVNLHNSLSSTQILSVCLLYEMSKEKKSFW 116 Query: 379 NYVKCYH 399 Y +H Sbjct: 117 -YPYLFH 122 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 28.7 bits (61), Expect = 3.5 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +1 Query: 112 HRADCLAETKADEQLVNKLKT-GDFKTENEPLKKYALCMLIKSQLMTKD-GKFKKDVALA 285 H D + E + + K++T GD+K EN L +Y C+L + +D G K + LA Sbjct: 227 HTVDLMLEAISKLPKMGKMQTFGDYKGENLFLNRYESCVLEWCDVCVEDFGPLMKLLRLA 286 Query: 286 KVPN 297 N Sbjct: 287 DGEN 290 >At1g66130.1 68414.m07505 oxidoreductase N-terminal domain-containing protein similar to AX110P [Daucus carota] GI:285739; contains Pfam profile PF01408: Oxidoreductase family NAD-binding Rossmann fold Length = 364 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 265 KKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAW 378 KK L + P A+D ++EK+++AC N T W Sbjct: 95 KKKHVLVEKPPAQDATELEKIVEACEYNGVQFMDGTIW 132 >At5g64710.2 68418.m08135 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 716 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +1 Query: 61 VVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 231 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 237 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 296 Query: 232 KSQLMTKDGKFKK 270 S KDG KK Sbjct: 297 VSSFEEKDGFLKK 309 >At5g64710.1 68418.m08134 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 841 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +1 Query: 61 VVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLI--- 231 VV + + K+N K + + ++ ++ V +K D K + EP+K L + Sbjct: 362 VVSVEKMCQNMKQNDKDVKEESHQLQESSQEFVQVMKLMDVKAKEEPVKANQLAITAVDD 421 Query: 232 KSQLMTKDGKFKK 270 S KDG KK Sbjct: 422 VSSFEEKDGFLKK 434 >At3g04810.2 68416.m00521 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 578 Score = 27.9 bits (59), Expect = 6.1 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = +1 Query: 55 VCVVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 234 VC+++ + E +KK E K + LV L ++ N L + C I Sbjct: 77 VCIIIGYCKGGDMAEAIKKTNGVHFTEEKLCKWLVQILLALEYLHANHILHRDVKCSNI- 135 Query: 235 SQLMTKDGKFK-KDVALAKVPNAED 306 +TKD + D LAKV ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKVLTSDD 158 >At3g04810.1 68416.m00520 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 606 Score = 27.9 bits (59), Expect = 6.1 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = +1 Query: 55 VCVVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 234 VC+++ + E +KK E K + LV L ++ N L + C I Sbjct: 77 VCIIIGYCKGGDMAEAIKKTNGVHFTEEKLCKWLVQILLALEYLHANHILHRDVKCSNI- 135 Query: 235 SQLMTKDGKFK-KDVALAKVPNAED 306 +TKD + D LAKV ++D Sbjct: 136 --FLTKDQDIRLGDFGLAKVLTSDD 158 >At1g57760.1 68414.m06553 expressed protein Length = 278 Score = 27.9 bits (59), Expect = 6.1 Identities = 23/75 (30%), Positives = 35/75 (46%) Frame = -1 Query: 288 FSQSDVLLEFPVLGHQLRFDQHT*SVLLQWFVFSLKVACLQFVHQLFISFRLGETVGSVF 109 F + L F + LR D+ S LL + + + F + S RL E + S F Sbjct: 131 FMVASSTLRFDLSPLLLRIDRVASSGLLIFAATKFTIKLILFHANIASSSRLLEILSS-F 189 Query: 108 LQVLLLLICEGLSQD 64 + +LLL+I G+S D Sbjct: 190 VLILLLMILSGISGD 204 >At3g20860.1 68416.m02637 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 427 Score = 27.5 bits (58), Expect = 8.0 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +1 Query: 55 VCVVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 234 VC+V + + + +KK R +E K +V L D+ N L + C I Sbjct: 87 VCIVTSYCEGGDMTQMIKKSRGVFASEEKLCRWMVQLLLAIDYLHNNRVLHRDLKCSNI- 145 Query: 235 SQLMTKDGKFK-KDVALAKVPNAED 306 +TK+ + + D LAK+ +D Sbjct: 146 --FLTKENEVRLGDFGLAKLLGKDD 168 >At2g04230.1 68415.m00410 F-box family protein contains F-box domain Pfam:PF00646 Length = 448 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 295 NAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 402 ++ KL++ KL D L + +P + WN KC E Sbjct: 333 DSSPKLQILKLTDVYLHDNKTNPDERKWNPPKCAPE 368 >At1g33670.1 68414.m04165 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to receptor kinase-like protein GB:AAB82755 GI:2586083 from [Oryza longistaminata] (Science 270 (5243), 1804-1806 (1995)) Length = 455 Score = 27.5 bits (58), Expect = 8.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 297 IRHFSQSDVLLEFPVLGHQLRFD 229 IR F+Q D ++EF G++L+FD Sbjct: 362 IRFFNQMDFMVEFHAPGNKLQFD 384 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,226,262 Number of Sequences: 28952 Number of extensions: 266518 Number of successful extensions: 719 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -