BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0463 (731 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071721-1|AAL49343.1| 152|Drosophila melanogaster RH37427p pro... 29 8.6 AE014297-2020|AAF55178.1| 152|Drosophila melanogaster CG6196-PA... 29 8.6 >AY071721-1|AAL49343.1| 152|Drosophila melanogaster RH37427p protein. Length = 152 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -2 Query: 202 INTYKFICVLYKMYLFKKNTDSFVCLFRNLYIIPTYALNVYSR 74 + T KFIC + M ++KK D+ +Y++ A +R Sbjct: 56 LETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTR 98 >AE014297-2020|AAF55178.1| 152|Drosophila melanogaster CG6196-PA protein. Length = 152 Score = 28.7 bits (61), Expect = 8.6 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -2 Query: 202 INTYKFICVLYKMYLFKKNTDSFVCLFRNLYIIPTYALNVYSR 74 + T KFIC + M ++KK D+ +Y++ A +R Sbjct: 56 LETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTR 98 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,778,752 Number of Sequences: 53049 Number of extensions: 549936 Number of successful extensions: 991 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 990 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3293648160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -