BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0461 (670 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0742 - 20630313-20630798 29 3.3 12_02_0141 + 14303418-14303687,14304447-14304586,14304744-14305569 28 5.9 >08_02_0742 - 20630313-20630798 Length = 161 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 343 VSVVTLSRSRRGGRVCAPTERKAISFGRRAAA 438 V VT R RRGGR C P + RR A Sbjct: 89 VRAVTTKRQRRGGRRCRPKRAATMKRQRRGGA 120 >12_02_0141 + 14303418-14303687,14304447-14304586,14304744-14305569 Length = 411 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 575 IVICARKQIKNVRRALINSRLRREAELT 492 + IC +I N+R AL+N ++ +E ELT Sbjct: 383 VSICQYLKIANMRDALLNQKMVQETELT 410 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,417,806 Number of Sequences: 37544 Number of extensions: 301845 Number of successful extensions: 800 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -