BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0461 (670 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36055-1|AAA62269.1| 118|Homo sapiens 4E-binding protein 1 prot... 37 0.075 CR456769-1|CAG33050.1| 118|Homo sapiens EIF4EBP1 protein. 37 0.075 BT007162-1|AAP35826.1| 118|Homo sapiens eukaryotic translation ... 37 0.075 BC058073-1|AAH58073.1| 118|Homo sapiens eukaryotic translation ... 37 0.075 BC004459-1|AAH04459.1| 118|Homo sapiens eukaryotic translation ... 37 0.075 AB044548-1|BAB18650.1| 118|Homo sapiens eukaryotic translation ... 37 0.075 >L36055-1|AAA62269.1| 118|Homo sapiens 4E-binding protein 1 protein. Length = 118 Score = 36.7 bits (81), Expect = 0.075 Identities = 25/88 (28%), Positives = 37/88 (42%) Frame = +1 Query: 376 GGRVCAPTERKAISFGRRAAAGVEVSREYNFVHFFSFGRVNSASRRSRLLIKARLTFLIC 555 GG C+ T +AI RR G V G + S + +I R + C Sbjct: 3 GGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMEC 62 Query: 556 LRAQMTMHPPR*GLVLPHLPAPDSNEPP 639 + +T PPR +P + +P S+EPP Sbjct: 63 RNSPVTKTPPRDLPTIPGVTSPSSDEPP 90 >CR456769-1|CAG33050.1| 118|Homo sapiens EIF4EBP1 protein. Length = 118 Score = 36.7 bits (81), Expect = 0.075 Identities = 25/88 (28%), Positives = 37/88 (42%) Frame = +1 Query: 376 GGRVCAPTERKAISFGRRAAAGVEVSREYNFVHFFSFGRVNSASRRSRLLIKARLTFLIC 555 GG C+ T +AI RR G V G + S + +I R + C Sbjct: 3 GGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMEC 62 Query: 556 LRAQMTMHPPR*GLVLPHLPAPDSNEPP 639 + +T PPR +P + +P S+EPP Sbjct: 63 RNSPVTKTPPRDLPTIPGVTSPSSDEPP 90 >BT007162-1|AAP35826.1| 118|Homo sapiens eukaryotic translation initiation factor 4E binding protein 1 protein. Length = 118 Score = 36.7 bits (81), Expect = 0.075 Identities = 25/88 (28%), Positives = 37/88 (42%) Frame = +1 Query: 376 GGRVCAPTERKAISFGRRAAAGVEVSREYNFVHFFSFGRVNSASRRSRLLIKARLTFLIC 555 GG C+ T +AI RR G V G + S + +I R + C Sbjct: 3 GGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMEC 62 Query: 556 LRAQMTMHPPR*GLVLPHLPAPDSNEPP 639 + +T PPR +P + +P S+EPP Sbjct: 63 RNSPVTKTPPRDLPTIPGVTSPSSDEPP 90 >BC058073-1|AAH58073.1| 118|Homo sapiens eukaryotic translation initiation factor 4E binding protein 1 protein. Length = 118 Score = 36.7 bits (81), Expect = 0.075 Identities = 25/88 (28%), Positives = 37/88 (42%) Frame = +1 Query: 376 GGRVCAPTERKAISFGRRAAAGVEVSREYNFVHFFSFGRVNSASRRSRLLIKARLTFLIC 555 GG C+ T +AI RR G V G + S + +I R + C Sbjct: 3 GGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMEC 62 Query: 556 LRAQMTMHPPR*GLVLPHLPAPDSNEPP 639 + +T PPR +P + +P S+EPP Sbjct: 63 RNSPVTKTPPRDLPTIPGVTSPSSDEPP 90 >BC004459-1|AAH04459.1| 118|Homo sapiens eukaryotic translation initiation factor 4E binding protein 1 protein. Length = 118 Score = 36.7 bits (81), Expect = 0.075 Identities = 25/88 (28%), Positives = 37/88 (42%) Frame = +1 Query: 376 GGRVCAPTERKAISFGRRAAAGVEVSREYNFVHFFSFGRVNSASRRSRLLIKARLTFLIC 555 GG C+ T +AI RR G V G + S + +I R + C Sbjct: 3 GGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMEC 62 Query: 556 LRAQMTMHPPR*GLVLPHLPAPDSNEPP 639 + +T PPR +P + +P S+EPP Sbjct: 63 RNSPVTKTPPRDLPTIPGVTSPSSDEPP 90 >AB044548-1|BAB18650.1| 118|Homo sapiens eukaryotic translation initiation factor 4E binding protein 1 protein. Length = 118 Score = 36.7 bits (81), Expect = 0.075 Identities = 25/88 (28%), Positives = 37/88 (42%) Frame = +1 Query: 376 GGRVCAPTERKAISFGRRAAAGVEVSREYNFVHFFSFGRVNSASRRSRLLIKARLTFLIC 555 GG C+ T +AI RR G V G + S + +I R + C Sbjct: 3 GGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMEC 62 Query: 556 LRAQMTMHPPR*GLVLPHLPAPDSNEPP 639 + +T PPR +P + +P S+EPP Sbjct: 63 RNSPVTKTPPRDLPTIPGVTSPSSDEPP 90 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,081,750 Number of Sequences: 237096 Number of extensions: 1528980 Number of successful extensions: 3004 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3004 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7591280850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -