BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0460 (605 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193890-1|AAO24709.1| 424|Homo sapiens zygote arrest 1 protein. 30 5.5 AY191416-1|AAO24707.1| 424|Homo sapiens zygote arrest 1 protein. 30 5.5 >AY193890-1|AAO24709.1| 424|Homo sapiens zygote arrest 1 protein. Length = 424 Score = 30.3 bits (65), Expect = 5.5 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -1 Query: 449 EYFRSCTGYSNPYQY*YIRATSGRRTACRSVVRSRDI-PKQP-RMDLVVCG 303 ++ R+C NPY+ I S ++T C V+ R + PK+P R DL CG Sbjct: 357 QFCRTCQKSYNPYRVEDITCQSCKQTRCSCPVKLRHVDPKRPHRQDL--CG 405 >AY191416-1|AAO24707.1| 424|Homo sapiens zygote arrest 1 protein. Length = 424 Score = 30.3 bits (65), Expect = 5.5 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -1 Query: 449 EYFRSCTGYSNPYQY*YIRATSGRRTACRSVVRSRDI-PKQP-RMDLVVCG 303 ++ R+C NPY+ I S ++T C V+ R + PK+P R DL CG Sbjct: 357 QFCRTCQKSYNPYRVEDITCQSCKQTRCSCPVKLRHVDPKRPHRQDL--CG 405 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,437,814 Number of Sequences: 237096 Number of extensions: 1778068 Number of successful extensions: 2586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2585 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6410414940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -