BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0460 (605 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68338-9|CAA92762.2| 2923|Caenorhabditis elegans Hypothetical pr... 27 7.9 Z68338-8|CAA92761.2| 2920|Caenorhabditis elegans Hypothetical pr... 27 7.9 Z54218-6|CAA90960.2| 2923|Caenorhabditis elegans Hypothetical pr... 27 7.9 Z54218-5|CAA90959.2| 2920|Caenorhabditis elegans Hypothetical pr... 27 7.9 >Z68338-9|CAA92762.2| 2923|Caenorhabditis elegans Hypothetical protein T24B8.7b protein. Length = 2923 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 9 LVSSFFFFFQRILSCALKDRYRGKIRNVIVKTGLNVFEVLIFLIK 143 L +S+ F+Q +L + ++ YR ++ IVK G + FE+ +K Sbjct: 1515 LNNSWVQFYQDVLVNSQQEAYRKYVQENIVKIGKDSFEITCVSLK 1559 >Z68338-8|CAA92761.2| 2920|Caenorhabditis elegans Hypothetical protein T24B8.7a protein. Length = 2920 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 9 LVSSFFFFFQRILSCALKDRYRGKIRNVIVKTGLNVFEVLIFLIK 143 L +S+ F+Q +L + ++ YR ++ IVK G + FE+ +K Sbjct: 1512 LNNSWVQFYQDVLVNSQQEAYRKYVQENIVKIGKDSFEITCVSLK 1556 >Z54218-6|CAA90960.2| 2923|Caenorhabditis elegans Hypothetical protein T24B8.7b protein. Length = 2923 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 9 LVSSFFFFFQRILSCALKDRYRGKIRNVIVKTGLNVFEVLIFLIK 143 L +S+ F+Q +L + ++ YR ++ IVK G + FE+ +K Sbjct: 1515 LNNSWVQFYQDVLVNSQQEAYRKYVQENIVKIGKDSFEITCVSLK 1559 >Z54218-5|CAA90959.2| 2920|Caenorhabditis elegans Hypothetical protein T24B8.7a protein. Length = 2920 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 9 LVSSFFFFFQRILSCALKDRYRGKIRNVIVKTGLNVFEVLIFLIK 143 L +S+ F+Q +L + ++ YR ++ IVK G + FE+ +K Sbjct: 1512 LNNSWVQFYQDVLVNSQQEAYRKYVQENIVKIGKDSFEITCVSLK 1556 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,766,746 Number of Sequences: 27780 Number of extensions: 289250 Number of successful extensions: 532 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1300523034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -