BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0454 (409 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0308 + 2229025-2229260,2229448-2230145,2230377-2230469,223... 27 5.7 10_06_0154 - 11291630-11292106,11292192-11292457,11293027-112931... 27 7.6 >06_01_0308 + 2229025-2229260,2229448-2230145,2230377-2230469, 2230815-2231992 Length = 734 Score = 27.1 bits (57), Expect = 5.7 Identities = 13/52 (25%), Positives = 27/52 (51%) Frame = -1 Query: 184 AGLGRLIVPVPLICNSXMVFFEINFVNYSKFKNIMNLYDKKCIYKKKTDEFK 29 +G+G VP+ ++ + F + F NY+ K ++N + + + D+FK Sbjct: 186 SGMGCCQVPI----STNLRRFSLGFYNYNTTKKVLNFSSRSYAFVVEKDQFK 233 >10_06_0154 - 11291630-11292106,11292192-11292457,11293027-11293131, 11293210-11293234,11293349-11293465,11293528-11294041, 11295524-11295578,11295980-11296060,11296129-11296219, 11296321-11296417,11297465-11297529,11297950-11298108, 11298208-11298455,11300667-11300835 Length = 822 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 91 KNIMNLYDKKCIYKKKTDEFKK 26 K +++ DKKCI KKK F+K Sbjct: 688 KEEVSIVDKKCIGKKKKRRFRK 709 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,594,581 Number of Sequences: 37544 Number of extensions: 175725 Number of successful extensions: 270 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 718652880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -