BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0450 (550 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 2.3 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 2.3 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 2.3 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 3.1 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 5.4 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 21 9.4 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.6 bits (46), Expect = 2.3 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 Query: 482 WPGRPATRIPR 450 WP RP ++PR Sbjct: 282 WPARPVNQVPR 292 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.6 bits (46), Expect = 2.3 Identities = 6/20 (30%), Positives = 10/20 (50%) Frame = +3 Query: 396 LWLMGAKSKWLRXRRTSGPG 455 +W + KW + +T G G Sbjct: 288 IWFQNRRMKWKKENKTKGEG 307 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 22.6 bits (46), Expect = 2.3 Identities = 6/20 (30%), Positives = 10/20 (50%) Frame = +3 Query: 396 LWLMGAKSKWLRXRRTSGPG 455 +W + KW + +T G G Sbjct: 290 IWFQNRRMKWKKENKTKGEG 309 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 482 WPGRPATRIP 453 WPGRP R P Sbjct: 37 WPGRPPKRAP 46 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.4 bits (43), Expect = 5.4 Identities = 11/40 (27%), Positives = 13/40 (32%) Frame = +1 Query: 253 CTGTRCPCSRPRSLSGFAPPTWRSSTGLAPASRRCCSGPS 372 C T CP RS + + P C GPS Sbjct: 21 CLITNCPRGGKRSKFAISENAVKPCVSCGPGQSGQCFGPS 60 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 20.6 bits (41), Expect = 9.4 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -3 Query: 125 NSARLFSFYG-FFEPMFAVDLNPVGAQRRYR 36 +S + YG F++P + +D N V YR Sbjct: 119 HSGAFMTGYGSFYQPDYFIDKNIVFVNLNYR 149 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,615 Number of Sequences: 336 Number of extensions: 2521 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -