BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0445 (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 2.0 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 6.1 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 6.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.1 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 6.1 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 22 6.1 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 380 TPEGSHHTQTTLRGHSIVHVCHRKFSKELQVQ 285 T G H + +R VCH+KF+ L +Q Sbjct: 180 THMGVHRAKPPMRVLHQCPVCHKKFTNALVLQ 211 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 628 LVNYRRNGKTVEAVCERL 575 LV+Y + KT+ A C R+ Sbjct: 174 LVDYMKKNKTLGAACGRI 191 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 628 LVNYRRNGKTVEAVCERL 575 LV+Y + KT+ A C R+ Sbjct: 488 LVDYMKKNKTLGAACGRI 505 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 628 LVNYRRNGKTVEAVCERL 575 LV+Y + KT+ A C R+ Sbjct: 721 LVDYMKKNKTLGAACGRI 738 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 628 LVNYRRNGKTVEAVCERL 575 LV+Y + KT+ A C R+ Sbjct: 721 LVDYMKKNKTLGAACGRI 738 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 506 CASINRIYGF 535 C S+NRI+GF Sbjct: 527 CDSVNRIFGF 536 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.8 bits (44), Expect = 6.1 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +3 Query: 516 SIGFMGFTMSAKGGITLNYGRRSQTASTVFPLRR*LTRKSSVVTAVCRL 662 SIGF F + L +G SQT + +F L R SV + RL Sbjct: 364 SIGFNCFWVMKLLYNVLRFGAESQTINFMFSFGFILLRFLSVFESCTRL 412 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,864 Number of Sequences: 336 Number of extensions: 4160 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -