BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0445 (755 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) 353 7e-98 SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) 165 3e-41 SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 1e-26 SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 3e-26 SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) 102 4e-22 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 77 1e-14 SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) 61 1e-09 SB_36816| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) 44 1e-04 SB_10504| Best HMM Match : MBOAT (HMM E-Value=0.16) 43 2e-04 SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 29 4.1 SB_42654| Best HMM Match : Tfb4 (HMM E-Value=0.0028) 29 5.4 SB_14102| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0024) 29 5.4 SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) 28 7.1 SB_3531| Best HMM Match : Cytomega_US3 (HMM E-Value=6.7) 28 9.4 SB_10885| Best HMM Match : COesterase (HMM E-Value=1.4) 28 9.4 >SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) Length = 293 Score = 353 bits (869), Expect = 7e-98 Identities = 156/172 (90%), Positives = 167/172 (97%) Frame = +2 Query: 134 DTDELNIDNVIKKLLKVRGEKPGMNVQLTEIEIKGLCLKSREIFLSQPILLELEAPLKIC 313 + ++LN+D++I +LL+VRG +PG NVQLTE EI+GLCLKSREIFLSQPILLELEAPLKIC Sbjct: 3 EPEKLNVDSIISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLKIC 62 Query: 314 GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR 493 GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR Sbjct: 63 GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR 122 Query: 494 GNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHG 649 GNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAI+DEKIFCCHG Sbjct: 123 GNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHG 174 >SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) Length = 173 Score = 165 bits (401), Expect = 3e-41 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 1/157 (0%) Frame = +2 Query: 215 LTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLF 394 L E ++K LC E+ L + + + +P+ +CGDIHGQ+YDL LF GG P ++Y+F Sbjct: 17 LPENDLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVF 76 Query: 395 LGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKL 571 +GD+VDRG SLET LL K K+P+ LLRGNHE I ++YGFYDEC+ +Y N Sbjct: 77 MGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQSKYGNANA 136 Query: 572 WKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQAMEQ 682 W+ F+ L VAAI+D ++ C HGGLSPD++ ++Q Sbjct: 137 WRYCCKVFDLLTVAAIIDGQVLCVHGGLSPDIKTIDQ 173 >SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 117 bits (281), Expect = 1e-26 Identities = 67/177 (37%), Positives = 97/177 (54%), Gaps = 32/177 (18%) Frame = +2 Query: 260 IFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI 439 I + +LE++AP+ +CGDIHGQ+YDL++LFE GG P + YLFLGDYVDRG S+E Sbjct: 69 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIE-- 126 Query: 440 CLLLAYKIKYPENFFLLRGNHECASINRIYGF---------------------YDECKR- 553 CL Y FLLRGNHEC + + F Y C R Sbjct: 127 CL-------YTNTLFLLRGNHECRHLTEYFTFKTESANFLDYITAREKMSPKQYINCARV 179 Query: 554 -RYNIKLWK------TFTDC---FNCLPVAAIVDEKIFCCHGGLSPDLQAMEQIRRI 694 Y +K K + C F+CLP+AA+++++ C HGGLSP++ ++ ++++ Sbjct: 180 THYTLKSGKIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKL 236 >SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 116 bits (278), Expect = 3e-26 Identities = 54/93 (58%), Positives = 71/93 (76%) Frame = +2 Query: 146 LNIDNVIKKLLKVRGEKPGMNVQLTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIH 325 L++DNVI++LL + + PG VQL E +I+ +C SREIFL QP+LLE+ AP+ I GDIH Sbjct: 10 LDVDNVIEQLLSYK-KNPGKQVQLPEAQIRQICQVSREIFLQQPMLLEIGAPINIFGDIH 68 Query: 326 GQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQ 424 GQY DLLR F+ G+PP +Y+FLGDYVDR K+ Sbjct: 69 GQYEDLLRHFDKLGYPPNESYIFLGDYVDRPKR 101 >SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) Length = 199 Score = 102 bits (244), Expect = 4e-22 Identities = 42/83 (50%), Positives = 62/83 (74%) Frame = +2 Query: 212 QLTEIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYL 391 QLTE ++K LC K++EI + + E++ P+ +CGD+HGQ++DL+ LF GG P++NYL Sbjct: 23 QLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYL 82 Query: 392 FLGDYVDRGKQSLETICLLLAYK 460 F+GDYVDRG S+ET+ LL+ K Sbjct: 83 FMGDYVDRGYYSVETVTLLVTLK 105 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 77.4 bits (182), Expect = 1e-14 Identities = 48/116 (41%), Positives = 66/116 (56%), Gaps = 7/116 (6%) Frame = +2 Query: 365 GFP-PESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASIN-RIYGFY 538 G P PE+ Y+F GD VDRG +S+E +L A+ I YP ++ RGNHE +N RI Sbjct: 2 GLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHEDHIMNLRIIVTK 61 Query: 539 DECKRRY---NIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLS--PDLQAMEQIRR 691 K +Y ++ +TF LP+A IV+ KIF HGG+S DL +E+I R Sbjct: 62 AGGKDQYKDSRSEIIRTFRKYLGWLPLATIVNNKIFVAHGGISNITDLDIIERIDR 117 >SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) Length = 720 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +2 Query: 239 LCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL----RLFEYGGFPPESNYLFLGDY 406 +C RE+ + +P +L +++P+ + GD+HG + DL+ L+ G SN+LFLGDY Sbjct: 652 VCRSLREVVMEEPRMLRVQSPVYVLGDLHGNFRDLVCFEKLLWRMGPVLTPSNFLFLGDY 711 Query: 407 VDRGKQSLE 433 VDRG+ +E Sbjct: 712 VDRGENGVE 720 >SB_36816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +3 Query: 699 RPTDVPDQGLLCDLLWSDP 755 RPTDVPD GLLCDLLWSDP Sbjct: 64 RPTDVPDTGLLCDLLWSDP 82 >SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) Length = 250 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/66 (36%), Positives = 34/66 (51%) Frame = +2 Query: 308 ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL 487 + GDIHG L +LFE +FLGDYVD +S TI L+ +I + Sbjct: 7 VFGDIHGGLRALQQLFERAEITINDKLIFLGDYVDGWSESAATIQFLI--EIAEKHDCIF 64 Query: 488 LRGNHE 505 ++GNH+ Sbjct: 65 IKGNHD 70 >SB_10504| Best HMM Match : MBOAT (HMM E-Value=0.16) Length = 465 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +3 Query: 699 RPTDVPDQGLLCDLLWSDP 755 RP DVPD+GL+CDLLWSDP Sbjct: 116 RPMDVPDKGLVCDLLWSDP 134 >SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 725 Score = 29.1 bits (62), Expect = 4.1 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 7/105 (6%) Frame = +2 Query: 65 SLFFYLFYSTIFRTHTIYPMADRDTDELNIDNVIKKLLKVRGEKPGMNVQLTEIEI---- 232 SLF LF + H Y +AD+ T ++N + V L + G+ ++ T I + Sbjct: 443 SLFSPLFDKIVEHYHAPYKLADKHTSDMNPEKVTAPNL----DPDGVFIRSTRIRVARNL 498 Query: 233 KGLCLKSREIFLSQPILLELEAPLKIC---GDIHGQYYDLLRLFE 358 KG L + + + +E + +C GD+ G+YY L + E Sbjct: 499 KGYAL-TPGLTRKERNEIEKKVTEVLCSLTGDLAGKYYPLTGMDE 542 >SB_42654| Best HMM Match : Tfb4 (HMM E-Value=0.0028) Length = 128 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 449 GAGILFPRTACHGPHSLQGRDSWTPEGSHHTQTTLR 342 G+ L+P+ +C G SL +DS + S T LR Sbjct: 67 GSKFLYPKASCEGIQSLPSQDSKYEKFSEFNDTVLR 102 >SB_14102| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0024) Length = 515 Score = 28.7 bits (61), Expect = 5.4 Identities = 22/79 (27%), Positives = 36/79 (45%) Frame = +2 Query: 374 PESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKR 553 P Y+ L D D K ++++ + K+K+ E+F EC S + + +EC R Sbjct: 405 PSRKYVSLRDTRDHRKVAMDSKSDIS--KLKWAEDFNF-ENPEECDS-DFNFENPEECVR 460 Query: 554 RYNIKLWKTFTDCFNCLPV 610 N +LW F C+ V Sbjct: 461 TLNDRLWNLFDQSSPCIKV 479 >SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) Length = 493 Score = 28.3 bits (60), Expect = 7.1 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 410 DRGKQSLETICLLLAYKIKYPENFFLLRGNHECA 511 D KQS T+C+LL Y+ KY E + + N EC+ Sbjct: 444 DTTKQSRRTVCMLL-YRAKYIEGCY-ISVNTECS 475 >SB_3531| Best HMM Match : Cytomega_US3 (HMM E-Value=6.7) Length = 519 Score = 27.9 bits (59), Expect = 9.4 Identities = 6/16 (37%), Positives = 14/16 (87%) Frame = +2 Query: 602 LPVAAIVDEKIFCCHG 649 +P++ ++D+++FCC G Sbjct: 71 VPISVVLDDRVFCCQG 86 >SB_10885| Best HMM Match : COesterase (HMM E-Value=1.4) Length = 195 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 519 IGFMGFTMSAKGGITLNYGRRSQTAS 596 +G GF + K G+T NYG Q S Sbjct: 160 VGIFGFLATGKNGVTGNYGMLDQVKS 185 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,759,925 Number of Sequences: 59808 Number of extensions: 500682 Number of successful extensions: 1432 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1425 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -