BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0444 (359 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1HQW7 Cluster: Mitochondrial NADH-ubiquinone oxidoredu... 79 2e-14 UniRef50_Q9VZ01 Cluster: CG11752-PA; n=3; Sophophora|Rep: CG1175... 73 2e-12 UniRef50_UPI00015B564B Cluster: PREDICTED: similar to mitochondr... 52 3e-06 UniRef50_Q8BK30 Cluster: NADH dehydrogenase [ubiquinone] flavopr... 42 0.002 UniRef50_UPI00015A60D1 Cluster: NADH dehydrogenase [ubiquinone] ... 39 0.023 UniRef50_Q4T4W4 Cluster: Chromosome undetermined SCAF9520, whole... 39 0.023 UniRef50_P56181 Cluster: NADH dehydrogenase [ubiquinone] flavopr... 36 0.16 UniRef50_Q8WU60 Cluster: NADH dehydrogenase (Ubiquinone) flavopr... 34 0.65 UniRef50_Q2VYF0 Cluster: Mitochondrial NADH oxidoreductase-like ... 34 0.86 UniRef50_Q7QHA5 Cluster: ENSANGP00000012694; n=1; Anopheles gamb... 33 2.0 UniRef50_UPI000155C493 Cluster: PREDICTED: hypothetical protein;... 32 3.5 UniRef50_Q95XG6 Cluster: Putative uncharacterized protein; n=2; ... 32 3.5 UniRef50_A0LAD6 Cluster: Glycosyl transferase, group 1; n=1; Mag... 31 4.6 UniRef50_Q8L4H4 Cluster: Nodulation receptor kinase precursor; n... 31 4.6 UniRef50_Q247Z9 Cluster: Putative uncharacterized protein; n=1; ... 31 6.1 UniRef50_A7EQZ9 Cluster: Predicted protein; n=1; Sclerotinia scl... 31 6.1 UniRef50_A7A6I4 Cluster: Putative uncharacterized protein; n=1; ... 31 8.0 UniRef50_Q6FSP0 Cluster: Similarities with sp|Q08957 Saccharomyc... 31 8.0 >UniRef50_Q1HQW7 Cluster: Mitochondrial NADH-ubiquinone oxidoreductase 9 kDa subunit-like protein; n=1; Aedes aegypti|Rep: Mitochondrial NADH-ubiquinone oxidoreductase 9 kDa subunit-like protein - Aedes aegypti (Yellowfever mosquito) Length = 103 Score = 79.4 bits (187), Expect = 2e-14 Identities = 35/59 (59%), Positives = 44/59 (74%) Frame = +3 Query: 93 EVNGLSSAVIHPASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 +V GLSS +H + P+GPG + G YKVPEY+CYD S+FEAEIEM K+RLPQPS+ Sbjct: 45 DVPGLSSKCVHSKTGPIGPGAS--RDGEYKVPEYYCYDKNSYFEAEIEMNKFRLPQPSS 101 >UniRef50_Q9VZ01 Cluster: CG11752-PA; n=3; Sophophora|Rep: CG11752-PA - Drosophila melanogaster (Fruit fly) Length = 109 Score = 72.9 bits (171), Expect = 2e-12 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = +3 Query: 96 VNGLSSAVIHPASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 V GL+S + P+S PVGPG TG YKVPEY+ ++ S+ EAE+EMAKYR PQPSA Sbjct: 52 VVGLTSNCVKPSSGPVGPGASA--TGGYKVPEYYSFNRFSYAEAEVEMAKYRCPQPSA 107 >UniRef50_UPI00015B564B Cluster: PREDICTED: similar to mitochondrial NADH-ubiquinone oxidoreductase 9 kDa subunit-like protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to mitochondrial NADH-ubiquinone oxidoreductase 9 kDa subunit-like protein - Nasonia vitripennis Length = 104 Score = 52.0 bits (119), Expect = 3e-06 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = +3 Query: 93 EVNGLSSAVIHPASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPS 266 EV GL++ V+ +Q VG K YK PEYFCY SF E+ +EM K+RLP PS Sbjct: 43 EVPGLTNKVVDVPNQAVGYA-GAAKDKEYKNPEYFCYHVDSFGESFVEMEKFRLPAPS 99 >UniRef50_Q8BK30 Cluster: NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial precursor; n=10; Murinae|Rep: NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial precursor - Mus musculus (Mouse) Length = 104 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/50 (34%), Positives = 31/50 (62%) Frame = +3 Query: 120 IHPASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 +HP +Q V +P T YK ++ Y+ +F + ++++K+RLPQPS+ Sbjct: 48 LHPKTQSVLKEPEPTDTTTYKNLQHHDYNTYTFLDLNLDLSKFRLPQPSS 97 >UniRef50_UPI00015A60D1 Cluster: NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (NADH-ubiquinone oxidoreductase 9 kDa subunit) (Complex I-9kD) (CI-9kD) (Renal carcinoma antigen NY-REN- 4).; n=4; Danio rerio|Rep: NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (NADH-ubiquinone oxidoreductase 9 kDa subunit) (Complex I-9kD) (CI-9kD) (Renal carcinoma antigen NY-REN- 4). - Danio rerio Length = 381 Score = 39.1 bits (87), Expect = 0.023 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +3 Query: 147 PGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 P +P YK ++ Y+ +F + ++EMAKYRLPQPS+ Sbjct: 334 PEPEPFDNTTYKNLQHHNYNMYTFTDMDVEMAKYRLPQPSS 374 >UniRef50_Q4T4W4 Cluster: Chromosome undetermined SCAF9520, whole genome shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome undetermined SCAF9520, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 392 Score = 39.1 bits (87), Expect = 0.023 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +3 Query: 129 ASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 A+ P P +P YK ++ Y +F + ++EMAKYRLPQP+A Sbjct: 344 AAAPPEPE-EPLDISTYKNYQHHSYHPFTFADMDVEMAKYRLPQPTA 389 >UniRef50_P56181 Cluster: NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial precursor; n=9; Eutheria|Rep: NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial precursor - Homo sapiens (Human) Length = 108 Score = 36.3 bits (80), Expect = 0.16 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 126 PASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 P +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 54 PPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 101 >UniRef50_Q8WU60 Cluster: NADH dehydrogenase (Ubiquinone) flavoprotein 3, 10kDa; n=7; Eutheria|Rep: NADH dehydrogenase (Ubiquinone) flavoprotein 3, 10kDa - Homo sapiens (Human) Length = 473 Score = 34.3 bits (75), Expect = 0.65 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +3 Query: 135 QPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 422 EPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 466 >UniRef50_Q2VYF0 Cluster: Mitochondrial NADH oxidoreductase-like protein; n=2; Eutheria|Rep: Mitochondrial NADH oxidoreductase-like protein - Homo sapiens (Human) Length = 112 Score = 33.9 bits (74), Expect = 0.86 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +3 Query: 135 QPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 61 KPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 105 >UniRef50_Q7QHA5 Cluster: ENSANGP00000012694; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000012694 - Anopheles gambiae str. PEST Length = 139 Score = 32.7 bits (71), Expect = 2.0 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 138 PVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEM-AKYRLPQPSA 269 P+ D K +YK PEYF Y N SF++ + YR+ QPSA Sbjct: 65 PIPMTGDAAKNFSYKNPEYFSYHNYSFYDIGRAIGCAYRV-QPSA 108 >UniRef50_UPI000155C493 Cluster: PREDICTED: hypothetical protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: hypothetical protein - Ornithorhynchus anatinus Length = 416 Score = 31.9 bits (69), Expect = 3.5 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +3 Query: 156 DPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 269 +P YK ++ Y +F + ++++K+RLPQPS+ Sbjct: 372 EPFDNSTYKNLQHHQYTAFTFLDFNLDLSKFRLPQPSS 409 >UniRef50_Q95XG6 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 83 Score = 31.9 bits (69), Expect = 3.5 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +3 Query: 177 YKVPEYFCYDNVSFFEAEIEMAKYRLPQPS 266 YK EY +D S+ AEI M K R+ QPS Sbjct: 42 YKCDEYLKFDKYSYAHAEITMNKDRVVQPS 71 >UniRef50_A0LAD6 Cluster: Glycosyl transferase, group 1; n=1; Magnetococcus sp. MC-1|Rep: Glycosyl transferase, group 1 - Magnetococcus sp. (strain MC-1) Length = 419 Score = 31.5 bits (68), Expect = 4.6 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = -3 Query: 324 Y*ITTLHLISSKLKFTF*-GPKVVAIGTSPSQFQLRRSSHYHNRNILELCTLRFF---LD 157 Y TT H +S L + P VV T P + HY R L+LC+L +F + Sbjct: 178 YATTTSHALSQALANAYQVSPPVVVYNTFPWAERASLKGHYRARKRLDLCSLVWFSQTIG 237 Query: 156 PHRG 145 P RG Sbjct: 238 PGRG 241 >UniRef50_Q8L4H4 Cluster: Nodulation receptor kinase precursor; n=49; Magnoliophyta|Rep: Nodulation receptor kinase precursor - Medicago truncatula (Barrel medic) Length = 925 Score = 31.5 bits (68), Expect = 4.6 Identities = 18/53 (33%), Positives = 31/53 (58%) Frame = -2 Query: 325 LLNYYITSNIKQIKIYFLRAEGCGNRYFAISISASKKLTLS*QKYSGTLYAPV 167 + + Y+ + IK+ K L A G N Y A++ISA+ L ++ K SG+ + P+ Sbjct: 290 VFDIYLNNEIKKEKFDVL-AGGSKNSYTALNISANGSLNITLVKASGSEFGPL 341 >UniRef50_Q247Z9 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1670 Score = 31.1 bits (67), Expect = 6.1 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -1 Query: 272 EGRRLWQSVLRHLNFSFEEAHIIITEIFWNFVRSGFFWI 156 EG+RLWQ + ++N +E++ ++ +IF N + F I Sbjct: 1372 EGKRLWQDIANYIN-QKKESYEVVNKIFSNIIAKLFIEI 1409 >UniRef50_A7EQZ9 Cluster: Predicted protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Predicted protein - Sclerotinia sclerotiorum 1980 Length = 142 Score = 31.1 bits (67), Expect = 6.1 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = -1 Query: 215 AHIIITEIFWNFVRSGFFWIHTG 147 +++++ + W+FVRS F+W+ G Sbjct: 108 SYVVVERVKWSFVRSAFWWVGNG 130 >UniRef50_A7A6I4 Cluster: Putative uncharacterized protein; n=1; Bifidobacterium adolescentis L2-32|Rep: Putative uncharacterized protein - Bifidobacterium adolescentis L2-32 Length = 393 Score = 30.7 bits (66), Expect = 8.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 172 PVFFGSTPGPTGCEAG*MTALLNPLTSGIVEFVG 71 P FG+ G TGC +G A+ NPL S ++ G Sbjct: 113 PTHFGTVLGITGCLSGLGGAIFNPLISHVIASYG 146 >UniRef50_Q6FSP0 Cluster: Similarities with sp|Q08957 Saccharomyces cerevisiae YPL202c; n=1; Candida glabrata|Rep: Similarities with sp|Q08957 Saccharomyces cerevisiae YPL202c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 437 Score = 30.7 bits (66), Expect = 8.0 Identities = 10/46 (21%), Positives = 25/46 (54%) Frame = +3 Query: 129 ASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPS 266 +S P+ P DP K+P+ ++NV++ + ++++ + P+ Sbjct: 383 SSTPISPSTDPSTDIDQKIPDPLEFENVNYLDKYVDLSTVMINDPA 428 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 339,891,906 Number of Sequences: 1657284 Number of extensions: 6331113 Number of successful extensions: 15186 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 14901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15182 length of database: 575,637,011 effective HSP length: 90 effective length of database: 426,481,451 effective search space used: 12367962079 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -