BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0433 (656 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar... 27 2.4 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 25 9.6 SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces pomb... 25 9.6 >SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1689 Score = 27.1 bits (57), Expect = 2.4 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 199 SWRRYKILKQSHPVKRMIRGIGAETTSTYSQ 291 S + YK L Q + VK ++ + +ET S+Y++ Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.0 bits (52), Expect = 9.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 294 FKWVRTPAYSNDEAGDL 344 F ++ P YS D+AGDL Sbjct: 443 FSALKVPVYSTDDAGDL 459 >SPCC1322.10 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 262 Score = 25.0 bits (52), Expect = 9.6 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 6/59 (10%) Frame = -2 Query: 238 PDETVLKFYIDASYPEGNFGRNQL------LDGSISLSPLYPVPTIDLHVRIATVLHQG 80 P+E V+ +A YP NF + LD IS+S P ++ AT +QG Sbjct: 49 PEEMVIMLVNNAHYPNQNFNLGTVQSSAGSLDTDISISSDLPTDGWQIYFNGATSQNQG 107 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,877,582 Number of Sequences: 5004 Number of extensions: 62126 Number of successful extensions: 130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -