BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0425 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11958| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_44717| Best HMM Match : 7tm_1 (HMM E-Value=0.001) 28 6.1 >SB_11958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 28.3 bits (60), Expect = 6.1 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 125 ACLPHNSTAWRTRDYRLICSLI 190 +C+ HNS AWR +D ++ ++I Sbjct: 102 SCITHNSQAWRFKDTQMFVNVI 123 >SB_44717| Best HMM Match : 7tm_1 (HMM E-Value=0.001) Length = 400 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 17 ESASDRCGPDTQTKTYAYNKHTKNIIIIETVTHVLWACL 133 ESAS+ GP T T T Y+K TK + T C+ Sbjct: 175 ESASEDLGPWTYTVTCQYDKDTKAVFFGATTVVYFVPCI 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,517,222 Number of Sequences: 59808 Number of extensions: 339661 Number of successful extensions: 596 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -