BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0425 (683 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48045-11|CAM33500.1| 887|Caenorhabditis elegans Hypothetical p... 29 4.1 Z48045-10|CAA88101.2| 849|Caenorhabditis elegans Hypothetical p... 29 4.1 >Z48045-11|CAM33500.1| 887|Caenorhabditis elegans Hypothetical protein C41C4.5b protein. Length = 887 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 44 DTQTKTYAYNKHTKNIII-IETVTHVLWACLPHNSTAWRTR 163 DT N HT + ++TV+ LW C P++S W+ + Sbjct: 242 DTNNTAGFMNLHTSRCLCQLDTVSKALWPCFPYSS--WKEK 280 >Z48045-10|CAA88101.2| 849|Caenorhabditis elegans Hypothetical protein C41C4.5a protein. Length = 849 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 44 DTQTKTYAYNKHTKNIII-IETVTHVLWACLPHNSTAWRTR 163 DT N HT + ++TV+ LW C P++S W+ + Sbjct: 204 DTNNTAGFMNLHTSRCLCQLDTVSKALWPCFPYSS--WKEK 242 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,794,285 Number of Sequences: 27780 Number of extensions: 259583 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -