BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0424 (740 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 281 1e-77 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 23 9.9 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 23 9.9 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 281 bits (690), Expect = 1e-77 Identities = 134/204 (65%), Positives = 151/204 (74%) Frame = +1 Query: 16 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQXXX 195 MGAYRY+QELYRKK SDVMR+LLRVR WQYRQ+TR HRAPRP RP + RRLGY+AK Sbjct: 1 MGAYRYVQELYRKKQSDVMRYLLRVRAWQYRQMTRFHRAPRPWRPTRLRRLGYKAKTGFS 60 Query: 196 XXXXXXXXXXXXXXXXXXATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXSSYW 375 TYGKPKSHGVNQLKP R LQS+AEE +SYW Sbjct: 61 IFRIRVRCGGRKRPVHKGCTYGKPKSHGVNQLKPYRCLQSVAEERVGGRLGGLRVLNSYW 120 Query: 376 VAQDSSYKYFEVILVDPSHKAIRRDPKINWIVNAVHKHREMRGLTSAGRSSRGLGKGHRY 555 VAQD+++KYFEVI+VDP + AIRRDP +NWI NAVHKHRE+RGLTSAG+SSRGLGK +RY Sbjct: 121 VAQDAAHKYFEVIMVDPPNNAIRRDPNVNWICNAVHKHRELRGLTSAGKSSRGLGKAYRY 180 Query: 556 SQTKGGSRRAAWLRRNTLQLRRKR 627 SQT GGSRRAA +RRN L LRR R Sbjct: 181 SQTIGGSRRAAGVRRNRLHLRRYR 204 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.0 bits (47), Expect = 9.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 138 PGSAVHTSQLTVLPYPHTQQKTH 70 PGS +SQ + + H QQ+ H Sbjct: 14 PGSGASSSQRSPFHHHHQQQQNH 36 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.0 bits (47), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 529 RGLGKGHRYSQTKGGSRR 582 +G+G GH Y + G RR Sbjct: 320 KGVGSGHLYYYEENGDRR 337 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 776,118 Number of Sequences: 2352 Number of extensions: 14852 Number of successful extensions: 41 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -